General Information

  • ID:  hor002431
  • Uniprot ID:  A0A8J5MZ09
  • Protein name:  Myosuppressin
  • Gene name:  Ms-L
  • Organism:  Homarus americanus (American lobster)
  • Family:  Myosuppressin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homarus (genus), Nephropidae (family), Nephropoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0016020 membrane

Sequence Information

  • Sequence:  QDLDHVFLRF
  • Length:  10(170-179)
  • Propeptide:  MKTVGCNTRNVDATQASKVCGVYPITLRLLADMKQQGYSHKQQHSVVTGLEVRRPRRELLQEMSKEITELTAGTLPSFEKSKEVRQTMVFRSCSWSCLLVVGVVVVMGVCVGVGETMPPPICLSQQVPLSPFAKKLCSALINISEFSRAMEEYLAIERSMPVNEPEVKRQDLDHVFLRFGRSQQ
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibit spontaneous contraction of muscles
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002431_AF2.pdbhor002431_ESM.pdb

Physical Information

Mass: 145018 Formula: C60H88N16O16
Absent amino acids: ACEGIKMNPSTWY Common amino acids: DFL
pI: 5.41 Basic residues: 2
Polar residues: 0 Hydrophobic residues: 5
Hydrophobicity: -8 Boman Index: -2272
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 107
Instability Index: 4752 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  22860213
  • Title:  Mass Spectral Charting of Neuropeptidomic Expression in the Stomatogastric Ganglion at Multiple Developmental Stages of the Lobster Homarus Americanus